PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000156241
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family Dof
Protein Properties Length: 378aa    MW: 41073.9 Da    PI: 7.8007
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000156241genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-3969129262
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  MDP0000156241  69 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 129
                    57899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-3371127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52573127IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-2674127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MLSNCDHEKM ALLISSTTNE WPQMQQDIQI DDIDHQRGLN NNNNAMSSST SSSANRIMEK  60
PGQEQLQLQQ QALKCPRCDS SNTKFCYYNN YSLSQPRHFC KACKRYWTRG GTLRNVPVGG  120
GCRKNKRVKR PGSTSSTSSA MDGGTPSSSS SVPSTTAAVN NNNSNPNSHP SHIDQINPLF  180
YGLSSNPFMD TASGFDLHQL NHQAQLGLGF SSSSGTNMMS SDNYRNRFNP ASNSSLPSNY  240
SSMFSTSPST TAPTVASVLA SKFINGGAFK DIQTRGPHQH NQYFQSLLPF EDLQIAAGSN  300
GEAGSASKDV KVEDHGGQNR LEWNNNNGSS NVNGNMNCQN QITEQMGLSD PTLYWNSSTL  360
GSNWHDPANL GSSVSSLI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.105490.0bud| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383710.10.0PREDICTED: dof zinc finger protein DOF1.4
TrEMBLM5X0R01e-155M5X0R0_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g00040.t013e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.13e-35Dof family protein